General Information

  • ID:  hor006535
  • Uniprot ID:  P21819
  • Protein name:  Diuretic hormone 1
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008613 diuretic hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007589 body fluid secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI
  • Length:  41(81-121)
  • Propeptide:  MMWWAIWCVMVVVSSAASAAPAPDSAPMDLVQIDSAGPDDESLGYAVSSLEGRYGAEAPWLYLLAEMPRDSQIGRAAVKRRMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDIGKRGLQWSRSEQPSAYY
  • Signal peptide:  MMWWAIWCVMVVVSSAASA
  • Modification:  T41 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P21819-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006535_AF2.pdbhor006535_ESM.pdb

Physical Information

Mass: 544625 Formula: C206H353N65O58S2
Absent amino acids: CGTWY Common amino acids: L
pI: 11.52 Basic residues: 9
Polar residues: 7 Hydrophobic residues: 16
Hydrophobicity: -34.15 Boman Index: -9875
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 109.51
Instability Index: 4804.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1279702
  • Title:  Characterization of the precursor for Manduca sexta diuretic hormone Mas-DH.
  • PubMed ID:  16594029
  • Title:  Isolation and identification of a diuretic hormone from the tobacco hornworm, Manduca sexta.